PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_14605_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 418aa    MW: 46409.5 Da    PI: 8.0507
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_14605_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-16118163147
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                           rg W + Ed +l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  cra_locus_14605_iso_1_len_1495_ver_3 118 RGHWRPAEDTKLRELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 163
                                           899*****************************.***********996 PP

2Myb_DNA-binding56.27.9e-18170213146
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           r ++T+eE+e+l  a++++G++ W+ Iar ++ gRt++ +k++w+ 
  cra_locus_14605_iso_1_len_1495_ver_3 170 RRAFTEEEEERLMAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 213
                                           678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.398113164IPR017930Myb domain
SMARTSM007174.6E-14117166IPR001005SANT/Myb domain
PfamPF002497.7E-16118163IPR001005SANT/Myb domain
SuperFamilySSF466897.49E-28118211IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-26119171IPR009057Homeodomain-like
CDDcd001675.53E-13121162No hitNo description
PROSITE profilePS5129427.288165219IPR017930Myb domain
SMARTSM007172.1E-14169217IPR001005SANT/Myb domain
PfamPF002492.6E-14170212IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-21172218IPR009057Homeodomain-like
CDDcd001671.35E-11172212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MANECKCSPN KSINISIDSY RPSSSPSPSH LGSMGTIFAD MGSLSINPIS YSPQETSFCN  60
NKSNGFPQNW DILEGKVSSD CSNESIDLNA GLSEEKNTTQ NGGKERSENS GQSKLCARGH  120
WRPAEDTKLR ELVALYGPQN WNLIAEKLEG RSGKSCRLRW FNQLDPRINR RAFTEEEEER  180
LMAAHRLYGN KWAMIARLFP GRTDNAVKNH WHVIMARKYR EQSSAYRRRK MGQLVCRKGE  240
DNDPPPPSFV TGETTAPPPP PPLPSYSFNN SNRAVAALGN LAAGGISCGS FSSPHLISPQ  300
TGFANDQTRC GHYFPGSSCS SNNGVMSIFN MNNMNSSSRD WDRPKRGESN MAYFYHQQIQ  360
QSQYYNQYPH SFSEVSSVTE IAAAESSSSA ELRDDRITNN PCEKIAPPFI DFLGVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-331182187107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070989.11e-112PREDICTED: transcriptional activator Myb
TrEMBLA0A068TWL51e-119A0A068TWL5_COFCA; Uncharacterized protein
STRINGVIT_01s0026g02600.t011e-110(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16842470